<meta name='google-adsense-platform-account' content='ca-host-pub-1556223355139109'/> <meta name='google-adsense-platform-domain' content='blogspot.com'/> <!-- --><style type="text/css">@import url(https://www.blogger.com/static/v1/v-css/navbar/3334278262-classic.css); div.b-mobile {display:none;} </style> </head><body><script type="text/javascript"> function setAttributeOnload(object, attribute, val) { if(window.addEventListener) { window.addEventListener('load', function(){ object[attribute] = val; }, false); } else { window.attachEvent('onload', function(){ object[attribute] = val; }); } } </script> <div id="navbar-iframe-container"></div> <script type="text/javascript" src="https://apis.google.com/js/platform.js"></script> <script type="text/javascript"> gapi.load("gapi.iframes:gapi.iframes.style.bubble", function() { if (gapi.iframes && gapi.iframes.getContext) { gapi.iframes.getContext().openChild({ url: 'https://www.blogger.com/navbar.g?targetBlogID\x3d5308543236282768168\x26blogName\x3dLOUISE\x26publishMode\x3dPUBLISH_MODE_BLOGSPOT\x26navbarType\x3dSILVER\x26layoutType\x3dCLASSIC\x26searchRoot\x3dhttps://technicoloresque.blogspot.com/search\x26blogLocale\x3den\x26v\x3d2\x26homepageUrl\x3dhttp://technicoloresque.blogspot.com/\x26vt\x3d3208562789735765075', where: document.getElementById("navbar-iframe-container"), id: "navbar-iframe", messageHandlersFilter: gapi.iframes.CROSS_ORIGIN_IFRAMES_FILTER, messageHandlers: { 'blogger-ping': function() {} } }); } }); </script>


READ ME









TWITTER


CHATBOX


ShoutMix chat widget


FAVOURITES

pinkpau
MLIA
lol
postsecret
To Do:
notebookdoodles
weheartit
kari-shma
yellow
bookshelves
thesixtyone
Billboard
the debating news

BOOMDEYADA, BOOMDEYADA, BOOM! DEYADA.
Saturday, May 30, 2009

 

Sister Brother

“Why do you keep eating all my sweets?!”

“But you told me that if I eat a lot of sweets I’ll become smarter! Like in Death Note, the L Guy!

 

There are little brothers, and then there are little brothers.

And there’s my little brother.

 

My sister, by the way, swears she never said that.

OHMYGAWD, WE’RE BACK AGAIN.
Friday, May 29, 2009

So I deleted the last post because it was too embarrassingly messy to let my blog be seen with it. The wonders of a full stomach.

The only thing I’m keeping from that post is:

I want pictures of you and your twin, Ru Jun!

And you better not have been pulling my leg or I’ll… I’ll… shout and scream and make faces at you!

(picked that up from Lily.)

And I AM jealous, because I want a twin brother too!

Instead all I end up with is this bratty 11-year-old who sneaks into my room and eats all the sweets out of my candy jar.

My dad just came back from dinner and he smells of alcohol! I’m going to go scold him now!

REVOLT AGAINST THE HONOR TO OBEY.
Saturday, May 23, 2009

 

stuffed animals

It super sucks to have to study while everyone else in other schools have already finished all their papers, but what to do. :(

HIATUS.

 

And I suggest all you bloggers follow suit so you don’t tempt me into coming online and reading your pretty pretty, funny funny blogs.

Then if I fail any papers in my midterms, I can blame you.

HAH.

EDITTTTTTTTT

Hiatus on hold, and my reasons, I believe, are justified.

So my name contains 4 out of the 5 vowels there are, but that’s no excuse for getting it wrong. I detest having my name misspelt, whether on purpose or not.

And believe me, I’ve had my name misspelt in just about every possible way. Not to mention mispronounced on top of it. Loiuse, Louis, Lois, Loese, Luise. My driver actually listed my name in his phonebook under LISE. (!!!)

For the last friggin time, my name is L-O-U-I-S-E.

And it’s pronounced LOU-EEEEZZZZ. Not LEWISSS. It’s FRENCH.

I particularly dislike it when people spell my name L-O-U-S-I-E. It sucks a lot. Misspell it any other way and it’s not so bad. Paling banyak I’ll give you a telling off and a spelling lesson.

But I particularly HATE people who spell my name like THAT. If you’re someone I know, CORRECT IT AND APOLOGIZE or I’ll come up with an appallingly rude misspelt version of your name for you in return. I already did that to a certain Drain. And I can do it again.

Watch me.

Back to hiatus now.

EDITTTTTTTTTTT

After this event, feel free to give me a good WAKEUPSLAP if you see me online before May 30th.

YOU CAN’T PLAY ON BROKEN STRINGS.
Wednesday, May 20, 2009

Saw this on Melissa Kong’s blog.

Read and ROFLYAO.

SHE SAID, DON’T CHANGE OUR LUCK.
Tuesday, May 19, 2009

 

Yuee Sun said something very random but flattering to me today. O.O HAHA.

And if I sit in front of Jian Kai and David for much longer, I shall go nuts. Both of them have ADD!!

Oh and I didn’t get shortlisted for the IMPAC Dublin thing. Neither did David. The winner’s out already. Which is a pity cause I got so stressed out over it. But it goes to show, I still have a lot to work on, and I can’t bite off more than I can chew. I know I’m not a perfect writer. I can definitely do better next round lah.

I still have next year! And anyway, I know my ending was AWESOME. :)

Oh oh, and congratulations Adeline and Melissa on getting shortlisted!!

My friends banyak talented kan? :D

And about the THING concerning Ed Board:

It's okay already. I still find what I saw on that page hurtful, but the actual shock and hurt feelings aren’t there anymore. She's just a little squirt girl. No point getting too worked up over her lah.

Lord forgive her, for she knows not what she does.
 
Too bad for her lah.
 
And ignoring my instincts (which is to corner her and demand WHY THE EFFIN HELL?), I think Si Jun's right:
 
Who cares what she said? We're the Ed Board. She's not. Not really. And we know we're better than what she made us out to be.
 
Way better. :)
 
PS: Ru Jun, don't be too disappointed. Haha.
 
And don’t worry about being an inactive Ed Board member, we love you anyway!

UPSHUT.
Tuesday, May 12, 2009

I typed a long explosion about stupid people who criticize people’s work when they were not involved in the process of the work itself.

And then, I thought,

You know WHAT?

Never mind.

Waste of spit trying to teach people sportsmanship.

provedwrong

Besides,

Sports Day is OVER.

So, I deleted the whole thing.

Oh and MARCHERS AR. WE LUBB YOU LAHHH ♥♥♥  OKAY?! :)

I swear, ONE MORE APOLOGY and I’ll take back everything I said!

On a lighter note, WATCH THIS VIDEO IF YOU HAVEN’T YET!Cause it makes my day every time I watch it.

AND WATCH THE ONE BELOW TOO!

And when you watch it right. Please be more APPRECIATIVE of this guy’s awesome piano skills. And DON’T BE LIKE IAN BEH. Show him this awesome video and all he can say is:

“HAHA! The dog in the video is JUST LIKE MINE!”

 

=_________=”

 

Yah. Anyway. Enjoy.

PS: Too bad for that itsy Form One kid. He’ll just never never ever get to find out what an awesome club the Editorial Board is.

 

:)

WEEEE AREEEE THE CHAMMMMPIONS
Saturday, May 9, 2009

 

“Everyone’s awesome. But there are some that are more awesome than others.”

- Louise T :)

And here go the THANKYOUS:

Ling Ming&Kimberley (the awesome captains!), Shen Wen (the awesome perkhemahan head. Read the posts below.), Yun Yee, Shu Yi, Shuk Pui (the incredible marching coordinators), Kai Yi, Rou Xin,  Livia and Jiun Shen (the awesome perkhemahan kakis).

And all the other Kuning peeps who bothered turning up to help with deco/marching – Rou Ann, Yu Li, Kay Zhi and the scouts (sorry lah, forgotten your names. :[ ), Emirul, Yee Hsiong, Dennis, Darren, Shih Xuan, Yi Wen, Joo Lin & friends.

Not forgetting all the runners that won us our 2nd place.

EDITTT.

Or the marchers, whom I’d like to thank one by one, but I can’t remember all their names! Except for a few.

And the MARVELOUS BARFELOUS TEACHER ADVISORS CIK NOR ASHIKIN AND MR CHAN FOI ONN. And they’re wonderful, cause they never go angry with us, even though we messed up all the PKS rooms. And Ashikin even helped us to go out and buy supplies! And she got us supper when they stayed overnight! They actively involved themselves in the khemah-building and the entire sports day. They gave their full support to all that we did.

I missed out a lot of people, I know. But that’s just off the top of my head. They’re the ones that make me proud to be a Rumah Kuning member.

We made tons of sacrifices – time, money, sleep. They were running around in school the night before, some doing marching, perkhemahan and even running the next day but they still stayed up late anyway. Nobody felt like going home or sleeping while there was so much work to be done.

Who would’ve known you’d all make such awesome team mates? :)

 

It’s kinda sad to realize that we won’t have this kind of thing in college. This was the last time.

And here go the CONGRATULATIONS and JIAYOUS.

Biru people, GOOD LUCK for next year. Your wolf was so so so pretty. I heard Sook Fah was the one that worked on it. I saw it yesterday morning and it gave me a shock ‘cause IT LOOKED SO REAL. Not that I was scared of it. But it meant that we had serious competition. At least, till I saw the rest of the khemah.

And to Merah people, congratulations on winning the marching! I clapped for you! And for the perkhemahan kakis, it’s SHIT that you got DQ-ed and we all know it. When I get my camera back I’ll post all the pictures of your khemah up so that the world will know how pretty it was and how much effort went into it. It’s not fair, but that’s life, really.

Anyway who cares what the judges think? The judges weren’t the ones that put in effort and care and inspiration. You guys did.

And only PERKHEMAHAN people (regardless of house) will understand how difficult it is to come up with a concept, design and then make it 3D. So only the opinions of the PERKHEMAHAN people matter. People who didn’t contribute to the khemah should just SHUT UP. And perkhemahan people don’t criticize other house’s khemah, cause they know all the effort behind it.

And on the field yesterday, every single person who worked on their house’s khemah KNEW that you all were the best. And only OUR opinion matters. So there, stupid judges. Last place, my foot. Take THAT.

Hijau, to be honest your khemah looked weird. But the mascot was the cutest mascot I’ve ever seen!!!!!!!! And congrats on the well deserved perbarisan 2nd place.

Ungu, no need to say anything la hor. *coughKaiBooncough*.

OH and yesterday during the L2 4X100m something happened.

Kuning and Merah were left in the race, and Kuning had just crossed the finish line, leaving Merah struggling behind. We were cheering away for Kuning .

And then I heard this conversation behind me.

PERSON ONE, PERSON TWO, PERSON THREE.

“MERAAAAAH! GO MERAH!”

“Ehh. Why you cheer for Merah. Lose ady lah.”

“Yeah. Kuning pass the finish line dy.”

“Yeah! Kuning finish already, left only Merah mah. So cheer for Merah! COME ON MERAH! YOU CAN DO IT! WOOOO!”

I turned around and you know who this person was?

THE ONE AND ONLY AARON NG JIN TING.

And FYI, he’s from Rumah Kuning.

O.O

(Which just goes to show how AWESOME the Rumah Kuning people are!)

I didn’t know whether tell him I was proud of him, laugh at him or just whack him.

So I just whacked him. Seemed the easiest to do at that point. But I have to credit him lah.

The Drain could take a sportsmanship lesson or two from Aaron!

And Kimberley’s right. See her blog. A lot of lessons learnt. I doubt the winners learn as much as the losers.

I learnt to cooperate.

To give my best.

To be a perfectionist.

To accept that I can’t win all the time.

That every year, only ONE house can win, and one house HAS to come in last.

To know that THE LOSERS MAKE THE WINNER. (Without losers, there aren’t any winners!)

So in more ways than one, this year’s Sports Day was just as good as last year’s. :)

PS: Marchers, seriously it’s okay. Whatever the results show, I know you guys are AWESOME!

GG.
Friday, May 8, 2009

OHMYGAWD.

 

IT’S OVER.

 

IT’S FINALLY OVER.

 

*gasps with relief*

I tell you, organizing Sports Day is like running a month-long marathon. I don’t know how Forrest Gump did it.

No more going to school on Saturday and Sunday!

No more stupid energy isotonic drinks that give us wind!

No more having to bend wire and cut cardboard till our fingers are all red and raw!

No more missing stationery!

No more panicking and flapping around like mad headless chickens!

No more having to stay at school from 7-5pm!

 

SPORTS DAY IS FINALLY

 OVER.

 

*Cue fellow Perkhemahan kakis: AMEN!*

Who am I kidding? I’m going to miss Sports Day when I get to college. :(

My dad didn’t let me stay overnight. I got to school at a quarter to five, having got up at 4am. The marchers were already there. And the costumes were so elaborate, and so very flimsy. :( As 7.30am got nearer and nearer, we Perkhemahan-ers were flapping around in a mad panic. No scissors, no staplers, NO MORE GLUE. OMG. A Sports Day nightmare. And then Kimberley woke up LATE, scaring the crap out of us. If I live to be sixty, I do not ever want to have to go through this morning ever again.

That wasn’t the worst though.

I’ll be really honest, marchers. The worst was when I watched you all perform. I wanted to cover my eyes and look away until someone told me it was over. Yes, it was that bad. And it really, really really broke our spirits. Because marchers are the cheerleaders of the house, and a lot of our semangat depends on you.

But I suppose the Perkhemahan-ers must take some responsibility for that. We certainly weren’t very calm this morning. Hmmm. :/

On the other hand, 2nd place for Perkhemahan. :D we screamed ourselves stupid.

So yeah, overall 2nd place as expected. And yes, it was REALLY REALLY COOL to be cheering for all the other houses as well as our own! I kind of got what I wished for on Monday. :)

Packed up with Kah Lok, Kimberley, Hock Eu and Shen Wen and went home at 3.30pm.

Ahhhhh my bones. My aching bones. I’m sunburnt and tired. I’m sleepy and I can’t think straight. So pardon this post being stupid and disjuncted. I really SHOULD go and sleep, but I can’t cause I want to tell you why I’m so proud of our marchers.

Yes, I’m proud of them. Even though they got 4th place and broke our spirits.

They were pretty upset too. But somewhere along the way, amidst all the cheering and screaming for our house, they got over it. And then when we gathered at the khemah, they actually apologized – as a group! – to all of us. Shen Wen was so touched that she cried. And they cheered for all of us to show their appreciation. And then they gave us their performance again.

And this time, it was STELLAR.

:)

Of course the captain had a point when he said, “Why now only you do nicely huh.”

But come on. They actually had the initiative to apologize. And the way they performed for us was awesome. No matter what the results show, I KNOW they’re number one.

I don’t think any of the other houses have marchers like ours. :)

So. In spite of the flop this morning. And the manic panic. And my slippers getting stolen (I had to borrow Shen Wen’s shoes back). And Kar Yee taking my wallet home by accident. And coming in 2nd to Rumah Ungu. Today was a HAPPY day. And I certainly learnt a lot more this year than I did last year.

The other stuff, like the thankyous and congratulationsacelebrations and the pictures can come later. Right now, Louise needs to SLEEP.

EDITTTTTT

LEFT MY CAMERA IN THE PKS ROOM. SHIT.

EDITTTTTTTTT

MAY THE PERSON WHO STOLE MY NEW SHINY COLOURFUL SLIPPERS FALL INTO A LONGKANG TOMORROW AND BREAK THEIR LEGS AND HAVE THEM AMPUTATED SO THEY CAN NEVER WEAR SHOES AGAIN.

PEACE.
Monday, May 4, 2009

… because nothing is worth fighting over. Ever.

I was very tempted to do this entire post in BIG RED BOLD LETTERS to emphasize what I’m thinking right now. But that’s too much, so, only some parts lah.

I am SICK and FED UP of all the rivalry there is between the sports houses right now. And I am SICK and TIRED of the way it’s created all this dischord in the Ed Board room and elsewhere. I don’t know about you but the rivalry is hardly friendly. And it really, really, REALLY sucks to hear someone who is not involved in the preparation of the perkhemahan say that our ideas suck, or whatever. It just SUCKS to hear our efforts being slammed and put down.

I had absolutely no mood to study today after I heard someone criticize Rumah Kuning’s deco. He said our theme sucks. (And in case you didn’t know, I’m on the deco team.)

Well. He told me to my face, really. Same effect.

And that same person said, “Don’t work so hard lah. You all gonna lose dy.”

Puh-lease. Saying that “my house rocks, yours sucks!” “You all sure lose dy lah.” is just plain fuh-reaking JUVENILE!

I’m not hearing these words from the stupid lower forms you know. Coming from them it’s normal. But it SUCKS ‘cause I’m hearing it from my own form mates.

And you’d think, that 5 years together would have made us closer and taught us to be a bit more mature and cooperative with each other.

Huh.

If we carry on like this, when sports day ends, there’ll be tears shed and a lot of bitterness leftover. Because I know that we, the rumah kuning deco team, are making a fecking lot of sacrifices. Especially Shen Wen.

Shen Wen skipped all her tuitions this week and last week. She stays back nearly every day and gives her ALL to rumah kuning. Even though barely enough people stay back, she stays back till 5pm close to every day just to see the deco work through. She comes out during PMO practice, during recess, and every other free period. She brings deco work to class and sits at the back during her free time to finish it. She uses her own money to buy supplies for deco. She and Kah Lok make dozens of calls and messages EVERY FECKING DAY to all the kuning members asking them to bring supplies and to come help. I really, really salute this girl ‘cause she’s so dedicated to seeing us through.

And you know what? I’ll be blatantly honest here: Rumah Kuning’s gone over our budget. We’ve overspent. We’re running on our own cash right now. We’re not getting our money back. Shen Wen’s not getting her money back.

And that’s just one person. I haven’t gotten started on Livia, who’s juggling debate and rumah kuning, or Kai Yi, or Jiun Shen, who are all fecking busy with debate and choir and every other thing but are coming at every opportunity they can.

It’s not enough, though. And we know it. Despite all those calls and announcements and messages, we don’t have enough equipment or enough people to help.

And all those people making stupid comments about the house’s deco being crap DOES NOT FECKING HELP AT ALL.

People from other houses, I don’t know if you’re in the same fix as we are but I KNOW it sucks when you give your all, and even more than what you have to give, for your house. And then other houses tell you you’re gonna lose. All out of stupid, stupid rivalry. It’s our last bloody year. If we lose – and even if we DON’T lose, SOMEONE is going to have to come in last, right? – it’ll make a very bitter memory. More bitter than it should be.

Why even bother criticizing other houses? I can’t find anything to criticize. Everyone’s ideas are awesome. What to do, we’re such an awesome school. :D

(So it’s really kind of a pity that all the awesome students in this awesome school are acting so juvenile.)

Today when we were working on the Rumah Kuning deco again. A Rumah Hijau member passed by, and he said, “Yeah! Go Rumah Kuning!”

I tell you. That’s the friendliest thing I’ve heard between houses all season. I nearly cried.

Yes, Kai Boon! Purple House rocks! I believe that you guys can do it and win. You’d deserve it too. :)

Green House, sorry lah I curi-curi tengok your deco the other day. It looks very the awesome. And, I told Joanna, I LOVE LOVE LOVE your marching chant-thingy. The stomponyourleftfoot one. It’s effing stuck in my head.

Red House, kudos to you ‘cause you chose such an awesome theme. It’s the most creative thing I’ve ever heard of and you’d deserve it if you won the perkhemahan competition. It’s no secret that all the other houses think so. Red House is awesome!

I haven’t seen anything from Blue House but during the raptai, I can hear you all cheering from my class. And we felt JEALOUS. You all are damn semangat-ed.

And I’m not just saying this. I believe that if we all focus on each other’s good points and APPRECIATE them (instead of sizing them up and saying, okay we gotta  figure out how to beat them at this), everybody would be much happier. That’s the way competition should be. That’s what sports day is meant to be about:

It’s the difference between competitiveness and sportsmanship. And there’s a world of difference between the two.

And then even if we lose by a margin of 500 points, suddenly all that money and time spent will be worth it.

It definitely will be.

GLORY, GLORY RUMAH KUNING.
Sunday, May 3, 2009

It’s THAT time of the year again. When the list of things of my mind goes like this.

HomeworkrumahkuningmidtermexamsperkhemahanarethreeweeksawayneedtodothebannerandIhaven’tstudiedskiptuitiontofinishthepaintinghavenoideawhatvectors areaboutrumahkuninghaven’tdoneaddmathsprojectrumahkuningorsivikprojectrumahkuningscholarshipapplicationsrumahkuninghomeworkpilinguprumahkuningrumahkuningRUMAHKUNING-

Yeah yeah. Being kiasu.

:(